Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VDAC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | VDAC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180069
|
Novus Biologicals
NBP180069 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP18006920
|
Novus Biologicals
NBP18006920UL |
20 μL | N/A | N/A | N/A | ||||
Description
VDAC3 Polyclonal specifically detects VDAC3 in Human samples. It is validated for Western Blot.Specifications
| VDAC3 | |
| Polyclonal | |
| Rabbit | |
| NP_005653 | |
| 7419 | |
| Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HD-VDAC3, hVDAC3, Outer mitochondrial membrane protein porin 3, VDAC-3, voltage-dependent anion channel 3, voltage-dependent anion-selective channel protein 3 | |
| VDAC3 | |
| IgG | |
| 31 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title