Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Testis expressed 264 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$480.74

Specifications

Antigen	Testis expressed 264
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP162424 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP162424	100 μL	Each of 1 for $480.74	Only null left	Sign In or Register to check your price. Add to Cart

Description

Testis expressed 264 Polyclonal specifically detects Testis expressed 264 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Testis expressed 264
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9Y6I9
Gene ID (Entrez)	51368
Immunogen	Synthetic peptides corresponding to TEX264(testis expressed 264) The peptide sequence was selected from the middle region of TEX264. Peptide sequence GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp451H0417, Putative secreted protein Zsig11, SIG11, testis expressed 264, testis expressed gene 264, testis expressed sequence 264, testis-expressed sequence 264 protein, ZSIG11FLJ13935
Gene Symbols	TEX264
Isotype	IgG
Molecular Weight of Antigen	34 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Testis expressed 264 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents