SUV3L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397270	Novus Biologicals NBP23404725UL	25 μL
NBP234047	Novus Biologicals NBP234047	0.1 mL

Description

SUV3L1 Polyclonal specifically detects SUV3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SUV3L1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP-dependent RNA helicase SUPV3L1, mitochondrial, EC 3.6.1, EC 3.6.4.13, suppressor of var1 (S.cerevisiae) 3-like 1, Suppressor of var1 3-like protein 1, suppressor of var1, 3-like 1 (S. cerevisiae), SUV3-like protein 1, SUV3suppressor of var1, 3-like 1(SUV3)
• Gene Symbols: SUPV3L1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q8IYB8
• Gene ID (Entrez): 6832
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only