Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PMM1/Phosphomannomutase 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$480.74

Specifications

Antigen	PMM1/Phosphomannomutase 1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155475 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155475	100 μL	Each of 1 for $480.74	Only null left	Sign In or Register to check your price. Add to Cart

Description

PMM1/Phosphomannomutase 1 Polyclonal specifically detects PMM1/Phosphomannomutase 1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PMM1/Phosphomannomutase 1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q92871
Gene ID (Entrez)	5372
Immunogen	Synthetic peptides corresponding to PMM1/Phosphomannomutase 1. The peptide sequence was selected from the N terminal of PMM1/Phosphomannomutase 1. Peptide sequence MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	brain glucose-1,6-bisphosphatase, EC 5.4.2.8, phosphomannomutase 1, PMM 1, PMMH22, PMMH-22, Sec53
Gene Symbols	PMM1
Isotype	IgG
Molecular Weight of Antigen	30 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PMM1/Phosphomannomutase 1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents