Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179948 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179948 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179948 Supplier Novus Biologicals Supplier No. NBP179948
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Nicotinic Acetylcholine R alpha 7/CHRNA7 Polyclonal specifically detects Nicotinic Acetylcholine R alpha 7/CHRNA7 in Human, Rat samples. It is validated for Western Blot.

Specifications

Antigen Nicotinic Acetylcholine R alpha 7/CHRNA7
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_000737
Gene Alias a7 nicotinic acetylcholine receptor, alpha 7 neuronal nicotinic acetylcholine receptor, alpha-7 nicotinic cholinergic receptor subunit, cholinergic receptor, nicotinic, alpha 7, cholinergic receptor, nicotinic, alpha polypeptide 7, CHRNA7-2, NACHRA7, neuronal acetylcholine receptor protein, alpha-7 chain, neuronal acetylcholine receptor subunit alpha-7
Gene Symbols CHRNA7
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human CHRNA7. Peptide sequence QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1139
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 93%; Chicken: 93%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.