Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Neprilysin-2/MMEL1 Antibody, Novus Biologicals™

Neprilysin-2/MMEL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15934920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15934920 20 μL
NBP159349 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15934920 Supplier Novus Biologicals Supplier No. NBP15934920UL

Description

Rabbit Polyclonal Antibody

Neprilysin-2/MMEL1 Polyclonal specifically detects Neprilysin-2/MMEL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Neprilysin-2/MMEL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias EC 3.4.24, EC 3.4.24.11, MELL1, membrane metallo-endopeptidase-like 1, Membrane metallo-endopeptidase-like 2MGC119455, MGC119454, MMEL2, NEP2, NEP2(m), NEPIIMGC119456, Neprilysin II, Neprilysin-2, NL2NL1, SEP, soluble secreted endopeptidase, zinc metallopeptidase
Gene Symbols MMEL1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79258
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.