Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104516

FSHPRH1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89104516 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
Catalog No. Quantity
89-104-516 50 μL
1 options

Catalog No. 89-104-516

Supplier: Abnova Corporation H00002491A01

Only null left
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant FSHPRH1.

The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. [provided by RefSeq

Sequence: KPLLFDHLAQLFFTSTIYFKCSVLQSLKELLQNWLLWLSMDIHMKPVTNSPL

Specifications

Antigen FSHPRH1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant FSHPRH1.
Formulation 50% glycerol
Gene CENPI
Gene Accession No. NM_006733
Gene Alias CENP-I/FSHPRH1/LRPR1/Mis6
Gene Symbols CENPI
Host Species Mouse
Immunogen FSHPRH1 (NP_006724, 471 a.a. to 522 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2491
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.