Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MafK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | MafK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MafK Polyclonal specifically detects MafK in Mouse samples. It is validated for Western Blot.Specifications
| MafK | |
| Polyclonal | |
| Rabbit | |
| NP_034887 | |
| 7975 | |
| The immunogen for this antibody is Mafk. Peptide sequence TTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ32205, MGC71717, transcription factor MafK, ubiquitous (p18), v-maf avian musculoaponeurotic fibrosarcoma oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian) | |
| MAFK | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title