Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109378

CPC Scientific H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 1MG
SDP

Supplier:  CPC Scientific GLUC010B

Encompass

The GLP-1 fragment is isolated from the lower small intestine and is presently regarded to be the most important incretin hormone. It shows a strong insulinotropic effect that is mediated by receptors expressed in the pancreatic beta-cells. It is proposed to be a novel therapeutic strategy for non-insulin-dependent (type 2) diabetes mellitus and associated neuropathy.SEQUENCE: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2ONE-LETTER SEQUENCE: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2MOLECULAR FORMULA: C149H226N40O45MOLECULAR WEIGHT: 3297.68STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [107444-51-9]SYNONYMS: GLP-1 fragment, Proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat), Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide 1 (7-36) amide (human, bovine, guinea pig, mouse, rat)RESEARCH AREA: DiabetesREFERENCES:G. Bell et al., Nature,

Catalog No. 50-210-9378


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.