Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gemin 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Specifications
| Antigen | Gemin 4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP152913
![]() |
Novus Biologicals
NBP152913 |
100 μL | N/A | N/A | N/A | ||||
Description
Gemin 4 Polyclonal specifically detects Gemin 4 in Human samples. It is validated for Western Blot.Specifications
| Gemin 4 | |
| Polyclonal | |
| Rabbit | |
| Q8WUM5 | |
| 50628 | |
| Synthetic peptides corresponding to GEMIN4(gem (nuclear organelle) associated protein 4) The peptide sequence was selected from the N terminal of GEMIN4. Peptide sequence QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| component of gems 4, DKFZp434B131, DKFZP434D174, gem (nuclear organelle) associated protein 4, gemin-4, HC56, HCAP1, HCC-associated protein 1, HHRF-1, p97DKFZp434D174 | |
| GEMIN4 | |
| IgG | |
| 120 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title