Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EIF4E3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

EIF4E3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7248711 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169565 25 μg
NB169564 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169565 Supplier Novus Biologicals Supplier No. NBP31724425UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

EIF4E3 Polyclonal antibody specifically detects EIF4E3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen EIF4E3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias eIF4E type 3, eIF-4E type 3, eIF-4E3, eIF4E-3, eukaryotic translation initiation factor 4E family member 3, eukaryotic translation initiation factor 4E member 3, eukaryotic translation initiation factor 4E type 3, MGC39820, MGC86971
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 317649
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.