Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
E2F3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26861025UL
Description
E2F3 Polyclonal antibody specifically detects E2F3 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| E2F3 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| DKFZp686C18211, E2F transcription factor 3, E2F-3, KIAA0075, MGC104598, transcription factor E2F3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSCSSSLQ | |
| 25 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 1871 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction