Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Choline Acetyltransferase/ChAT Antibody (CL3173), Novus Biologicals™

Choline Acetyltransferase/ChAT Antibody (CL3173), Novus Biologicals™
SDP

Catalog No. p-200058198 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396387 25 μL
NBP246620 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396387 Supplier Novus Biologicals Supplier No. NBP24662025UL
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Choline Acetyltransferase/ChAT Monoclonal antibody specifically detects Choline Acetyltransferase/ChAT in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen Choline Acetyltransferase/ChAT
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3173
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P28329
Gene Alias acetyl CoA:choline O-acetyltransferase, ChAT, CHOACTase, Choline acetylase, choline acetyltransferase, choline O-acetyltransferase, CMS1A, CMS1A2, EC 2.3.1, EC 2.3.1.6
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 1103
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.