Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CHD9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

CHD9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169533 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169533 25 μg
NB169532 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB169533 Supplier Novus Biologicals Supplier No. NBP31722825UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CHD9 Polyclonal antibody specifically detects CHD9 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen CHD9
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias AD013, ATP-dependent helicase CHD9, BC022889, CHD-9, chromatin remodeling factor CHROM1, Chromatin-related mesenchymal modulator, Chromatin-remodeling factor CHROM1, chromodomain helicase DNA binding protein 9, chromodomain-helicase-DNA-binding protein 9, ciprofibrate bound protein p240, CReMM, EC 3.6.1, EC 3.6.4.12, FLJ12178, KIAA0308, KISH2, Kismet homolog 2, Peroxisomal proliferator-activated receptor A-interacting complex 320 kDaprotein, PPAR{gamma}-interacting cofactor 320 kDa, PPAR-alpha-interacting complex protein 320 kDa, PRIC320, proteinx0008
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80205
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.