sodium channel, voltage-gated, type IX, alpha subunit, Mouse, Clone: 5A11, Abnova™

Catalog No.	Quantity
89-014-186	100 μg

Catalog No. 89-014-186

Supplier: Abnova Corporation H00006335M01

Description

Mouse monoclonal antibody raised against a partial recombinant SCN9A.

This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq

Sequence: GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY

Specifications

• Antigen: sodium channel, voltage-gated, type IX, alpha subunit
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5A11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SCN9A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SCN9A
• Gene Accession No.: NM_002977
• Gene Alias: ETHA/NE-NA/NENA/Nav1.7/PN1
• Gene Symbols: SCN9A
• Host Species: Mouse
• Immunogen: SCN9A (NP_002968, 269 a.a. ∼ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6335
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ