K(lysine) acetyltransferase 2B, Mouse, Clone: 1H2, Abnova™

Catalog No.	Quantity
89-014-228	100 μg

Catalog No. 89-014-228

Supplier: Abnova Corporation H00008850M02

Description

Mouse monoclonal antibody raised against a partial recombinant PCAF.

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq

Sequence: LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME

Specifications

• Antigen: K(lysine) acetyltransferase 2B
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PCAF.
• Formulation: PBS with no preservative; pH 7.4
• Gene: KAT2B
• Gene Accession No.: BC060823
• Gene Alias: CAF/P/P/CAF/PCAF
• Gene Symbols: KAT2B
• Host Species: Mouse
• Immunogen: PCAF (AAH60823, 353 a.a. ∼ 452 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 8850
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ