guanine monphosphate synthetase, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GMPS.

Supplier:  Abnova Corporation H00008833A01

Catalog No. 89-004-408

Description

In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. [provided by RefSeq

Sequence: QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG

Specifications

• Antigen: guanine monphosphate synthetase
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GMPS.
• Gene: GMPS
• Gene Symbols: GMPS
• Immunogen: GMPS (NP_003866, 108 a.a. ∼ 215 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003875
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 8833
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.